![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.3: TENA/THI-4 [101458] (8 proteins) Pfam PF03070; HO-related family lacking the heme-binding site |
![]() | Protein Transcriptional activator TenA [110030] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries) |
![]() | Domain d1tyhd_: 1tyh D: [107460] |
PDB Entry: 1tyh (more details), 2.54 Å
SCOP Domain Sequences for d1tyhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyhd_ a.132.1.3 (D:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd elaensteevrakmkenfvissyyeyqfwgmayrkegwsds
Timeline for d1tyhd_: