SCOP 1.69: Domain d1tyhd_: 1tyh D:

Lineage for d1tyhd_ (1tyh D:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (4 proteins)
   Pfam 03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (2 PDB entries)

8. Domain d1tyhd_: 1tyh D: [107460]

Details for d1tyhd_

PDB Entry: 1tyh, 2.54 Å

PDB Description: crystal structure of transcriptional activator tena from bacillus subtilis

SCOP Domain Sequences for d1tyhd_:

Sequence; same for both SEQRES and ATOM records:

>d1tyhd_ a.132.1.3 (D:) Transcriptional activator TenA {Bacillus subtilis}
lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
elaensteevrakmkenfvissyyeyqfwgmayrkegwsds

Timeline for d1tyhd_:

• d1tyhd_ is new in SCOP 1.69
  
• d1tyhd_ appears in SCOP 1.71
  
• d1tyhd_ appears in the current release, SCOPe 2.08, called d1tyhd1