SCOPe 2.08: Domain d1tyhd1: 1tyh D:2-221

Lineage for d1tyhd1 (1tyh D:2-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
   Uniprot P25052

8. Domain d1tyhd1: 1tyh D:2-221 [107460]
   Other proteins in same PDB: d1tyha2, d1tyhb2, d1tyhd2, d1tyhe2

Details for d1tyhd1

PDB Entry: 1tyh, 2.54 Å

PDB Description: crystal structure of transcriptional activator tena from bacillus subtilis

PDB Compounds: (D:) Transcriptional activator tenA

SCOPe Domain Sequences for d1tyhd1:

Sequence; same for both SEQRES and ATOM records:

>d1tyhd1 a.132.1.3 (D:2-221) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegwsds

Timeline for d1tyhd1:

• d1tyhd1 first appeared in SCOP 1.69, called d1tyhd_
  
• d1tyhd1 appears in SCOPe 2.07