SCOP 1.73: Domain d1tyha_: 1tyh A:

Lineage for d1tyha_ (1tyh A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries)

8. Domain d1tyha_: 1tyh A: [107458]

Details for d1tyha_

PDB Entry: 1tyh, 2.54 Å

PDB Description: crystal structure of transcriptional activator tena from bacillus subtilis

PDB Compounds: (A:) Transcriptional activator tenA

SCOP Domain Sequences for d1tyha_:

Sequence; same for both SEQRES and ATOM records:

>d1tyha_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
elaensteevrakmkenfvissyyeyqfwgmayrkegwsds

Timeline for d1tyha_:

• d1tyha_ first appeared in SCOP 1.69
  
• d1tyha_ appears in SCOP 1.71
  
• d1tyha_ appears in SCOP 1.75
  
• d1tyha_ appears in the current release, SCOPe 2.08, called d1tyha1