Lineage for d1tyha1 (1tyh A:2-221)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. Protein Transcriptional activator TenA [110030] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
    Uniprot P25052
  8. Domain d1tyha1: 1tyh A:2-221 [107458]
    Other proteins in same PDB: d1tyha2, d1tyhb2, d1tyhd2, d1tyhe2

Details for d1tyha1

PDB Entry: 1tyh (more details), 2.54 Å

PDB Description: crystal structure of transcriptional activator tena from bacillus subtilis
PDB Compounds: (A:) Transcriptional activator tenA

SCOPe Domain Sequences for d1tyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyha1 a.132.1.3 (A:2-221) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegwsds

SCOPe Domain Coordinates for d1tyha1 are not available.

Timeline for d1tyha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tyha2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tyhb1, d1tyhb2, d1tyhd1, d1tyhd2, d1tyhe1, d1tyhe2