SCOPe 2.04: Domain d1tygc_: 1tyg C:

Lineage for d1tygc_ (1tyg C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.31: ThiG-like [110399] (2 families)
   shares the common phosphate-binding site with other superfamilies

5. Family c.1.31.1: ThiG-like [110400] (1 protein)
   Pfam PF05690

6. Protein Thiazole biosynthesis protein ThiG [110401] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [110402] (2 PDB entries)
   Uniprot O31618

8. Domain d1tygc_: 1tyg C: [107456]
   Other proteins in same PDB: d1tygb_, d1tygg_
   complexed with po4

Details for d1tygc_

PDB Entry: 1tyg, 3.15 Å

PDB Description: Structure of the thiazole synthase/ThiS complex

PDB Compounds: (C:) Thiazole biosynthesis protein thiG

SCOPe Domain Sequences for d1tygc_:

Sequence, based on SEQRES records:

>d1tygc_ c.1.31.1 (C:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}
mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld
lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql
leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi
vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk
qyg

Sequence, based on observed residues (ATOM records):

>d1tygc_ c.1.31.1 (C:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}
mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfafeasqpnfleqldlskytl
lpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseqlleegfi
vlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvivdagig
spkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplkqyg

Timeline for d1tygc_:

• d1tygc_ first appeared in SCOP 1.69
  
• d1tygc_ appears in SCOPe 2.03
  
• d1tygc_ appears in SCOPe 2.05
  
• d1tygc_ appears in the current release, SCOPe 2.08