Lineage for d1tygc_ (1tyg C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.31: ThiG-like [110399] (2 families) (S)
    shares the common phosphate-binding site with other superfamilies
  5. Family c.1.31.1: ThiG-like [110400] (1 protein)
    Pfam PF05690
  6. Protein Thiazole biosynthesis protein ThiG [110401] (2 species)
  7. Species Bacillus subtilis [TaxId:1423] [110402] (2 PDB entries)
    Uniprot O31618
  8. Domain d1tygc_: 1tyg C: [107456]
    Other proteins in same PDB: d1tygb_, d1tygg_
    complexed with po4

Details for d1tygc_

PDB Entry: 1tyg (more details), 3.15 Å

PDB Description: Structure of the thiazole synthase/ThiS complex
PDB Compounds: (C:) Thiazole biosynthesis protein thiG

SCOPe Domain Sequences for d1tygc_:

Sequence, based on SEQRES records: (download)

>d1tygc_ c.1.31.1 (C:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}
mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld
lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql
leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi
vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk
qyg

Sequence, based on observed residues (ATOM records): (download)

>d1tygc_ c.1.31.1 (C:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}
mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfafeasqpnfleqldlskytl
lpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseqlleegfi
vlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvivdagig
spkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplkqyg

SCOPe Domain Coordinates for d1tygc_ are not available.

Timeline for d1tygc_:

Domains from other chains:
(mouse over for more information)
d1tyga_, d1tygb_, d1tygg_