Lineage for d1tyga_ (1tyg A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476933Superfamily c.1.31: ThiG-like (Pfam 05690) [110399] (1 family) (S)
    shares the common phosphate-binding site with other superfamilies
  5. 476934Family c.1.31.1: ThiG-like (Pfam 05690) [110400] (1 protein)
  6. 476935Protein Thiazole biosynthesis protein ThiG [110401] (1 species)
  7. 476936Species Bacillus subtilis [TaxId:1423] [110402] (1 PDB entry)
  8. 476937Domain d1tyga_: 1tyg A: [107454]
    Other proteins in same PDB: d1tygb_, d1tygg_

Details for d1tyga_

PDB Entry: 1tyg (more details), 3.15 Å

PDB Description: Structure of the thiazole synthase/ThiS complex

SCOP Domain Sequences for d1tyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyga_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis}
mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld
lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql
leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi
vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk
qy

SCOP Domain Coordinates for d1tyga_:

Click to download the PDB-style file with coordinates for d1tyga_.
(The format of our PDB-style files is described here.)

Timeline for d1tyga_: