Lineage for d1tyga_ (1tyg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840901Superfamily c.1.31: ThiG-like [110399] (2 families) (S)
    shares the common phosphate-binding site with other superfamilies
  5. 2840902Family c.1.31.1: ThiG-like [110400] (1 protein)
    Pfam PF05690
  6. 2840903Protein Thiazole biosynthesis protein ThiG [110401] (2 species)
  7. 2840904Species Bacillus subtilis [TaxId:1423] [110402] (2 PDB entries)
    Uniprot O31618
  8. 2840909Domain d1tyga_: 1tyg A: [107454]
    Other proteins in same PDB: d1tygb_, d1tygg_
    complexed with po4

Details for d1tyga_

PDB Entry: 1tyg (more details), 3.15 Å

PDB Description: Structure of the thiazole synthase/ThiS complex
PDB Compounds: (A:) Thiazole biosynthesis protein thiG

SCOPe Domain Sequences for d1tyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyga_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}
mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld
lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql
leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi
vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk
qy

SCOPe Domain Coordinates for d1tyga_:

Click to download the PDB-style file with coordinates for d1tyga_.
(The format of our PDB-style files is described here.)

Timeline for d1tyga_: