![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein Apoptosis regulator ced-9 [103424] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [103425] (2 PDB entries) Uniprot P41958 74-237 |
![]() | Domain d1ty4b_: 1ty4 B: [107453] complexed with the activator egl-1 peptide (Uniprot O61667 48-76), chains C and D |
PDB Entry: 1ty4 (more details), 2.2 Å
SCOPe Domain Sequences for d1ty4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty4b_ f.1.4.1 (B:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ndweeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkhaen fetfceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmmesve lqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedye
Timeline for d1ty4b_: