Lineage for d1ty4a_ (1ty4 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2626683Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2626803Protein Apoptosis regulator ced-9 [103424] (1 species)
  7. 2626804Species Nematode (Caenorhabditis elegans) [TaxId:6239] [103425] (2 PDB entries)
    Uniprot P41958 74-237
  8. 2626807Domain d1ty4a_: 1ty4 A: [107452]
    complexed with the activator egl-1 peptide (Uniprot O61667 48-76), chains C and D

Details for d1ty4a_

PDB Entry: 1ty4 (more details), 2.2 Å

PDB Description: Crystal structure of a CED-9/EGL-1 complex
PDB Compounds: (A:) Apoptosis regulator ced-9

SCOPe Domain Sequences for d1ty4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty4a_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
eeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkhaenfet
fceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmmesvelqg
qvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyer

SCOPe Domain Coordinates for d1ty4a_:

Click to download the PDB-style file with coordinates for d1ty4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ty4a_: