Lineage for d1ty4a_ (1ty4 A:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619387Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 619427Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 619428Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (9 proteins)
    Pfam 00452
  6. 619449Protein Apoptosis regulator ced-9 [103424] (1 species)
  7. 619450Species Nematode (Caenorhabditis elegans) [TaxId:6239] [103425] (2 PDB entries)
  8. 619453Domain d1ty4a_: 1ty4 A: [107452]

Details for d1ty4a_

PDB Entry: 1ty4 (more details), 2.2 Å

PDB Description: Crystal structure of a CED-9/EGL-1 complex

SCOP Domain Sequences for d1ty4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty4a_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans)}
eeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkhaenfet
fceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmmesvelqg
qvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyer

SCOP Domain Coordinates for d1ty4a_:

Click to download the PDB-style file with coordinates for d1ty4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ty4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ty4b_