SCOP 1.69: Domain d1ty4a_: 1ty4 A:

Lineage for d1ty4a_ (1ty4 A:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (8 proteins)

6. Protein Apoptosis regulator ced-9 [103424] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [103425] (2 PDB entries)

8. Domain d1ty4a_: 1ty4 A: [107452]

Details for d1ty4a_

PDB Entry: 1ty4, 2.2 Å

PDB Description: Crystal structure of a CED-9/EGL-1 complex

SCOP Domain Sequences for d1ty4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ty4a_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans)}
eeprldiegfvvdyfthrirqngmewfgapglpcgvqpehemmrvmgtifekkhaenfet
fceqllavprisfspyqdvvrtvgnaqtdqcpmsygrliglisfggfvaakmmesvelqg
qvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyer

Timeline for d1ty4a_:

• d1ty4a_ is new in SCOP 1.69
  
• d1ty4a_ appears in SCOP 1.71
  
• d1ty4a_ appears in the current release, SCOPe 2.08