SCOPe 2.08: Domain d1ty2c1: 1ty2 C:4-99

Lineage for d1ty2c1 (1ty2 C:4-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Streptococcal pyrogenic exotoxin Spe-J [110192] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [110193] (2 PDB entries)
   Uniprot Q7BAE3

8. Domain d1ty2c1: 1ty2 C:4-99 [107450]
   Other proteins in same PDB: d1ty2a2, d1ty2b2, d1ty2c2
   complexed with zn

Details for d1ty2c1

PDB Entry: 1ty2, 2 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)

PDB Compounds: (C:) putative exotoxin (superantigen)

SCOPe Domain Sequences for d1ty2c1:

Sequence; same for both SEQRES and ATOM records:

>d1ty2c1 b.40.2.2 (C:4-99) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes [TaxId: 1314]}
senikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyittk
ftknqkvnifglpyiftrydvyyiyggvtpsvnsns

Timeline for d1ty2c1:

• d1ty2c1 first appeared in SCOP 1.69
  
• d1ty2c1 appears in SCOPe 2.07