Lineage for d1ty2b2 (1ty2 B:104-211)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 599052Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 599053Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 599153Protein Streptococcal pyrogenic exotoxin Spe-J [110812] (1 species)
  7. 599154Species Streptococcus pyogenes [TaxId:1314] [110813] (2 PDB entries)
  8. 599159Domain d1ty2b2: 1ty2 B:104-211 [107449]
    Other proteins in same PDB: d1ty2a1, d1ty2b1, d1ty2c1

Details for d1ty2b2

PDB Entry: 1ty2 (more details), 2 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)

SCOP Domain Sequences for d1ty2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty2b2 d.15.6.1 (B:104-211) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes}
ivgnllidgvqqktlinpikidkpiftiqefdfkirqylmqtykiydpnspyikgqleia
ingnkhesfnlydatssstrsdifkkykdnktinmkdfshfdiylwtk

SCOP Domain Coordinates for d1ty2b2:

Click to download the PDB-style file with coordinates for d1ty2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ty2b2: