Lineage for d1ty2b2 (1ty2 B:104-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934506Protein Streptococcal pyrogenic exotoxin Spe-J [110812] (1 species)
  7. 2934507Species Streptococcus pyogenes [TaxId:1314] [110813] (2 PDB entries)
    Uniprot Q7BAE3
  8. 2934512Domain d1ty2b2: 1ty2 B:104-211 [107449]
    Other proteins in same PDB: d1ty2a1, d1ty2b1, d1ty2c1
    complexed with zn

Details for d1ty2b2

PDB Entry: 1ty2 (more details), 2 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)
PDB Compounds: (B:) putative exotoxin (superantigen)

SCOPe Domain Sequences for d1ty2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty2b2 d.15.6.1 (B:104-211) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes [TaxId: 1314]}
ivgnllidgvqqktlinpikidkpiftiqefdfkirqylmqtykiydpnspyikgqleia
ingnkhesfnlydatssstrsdifkkykdnktinmkdfshfdiylwtk

SCOPe Domain Coordinates for d1ty2b2:

Click to download the PDB-style file with coordinates for d1ty2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ty2b2: