SCOP 1.69: Domain d1ty0c1: 1ty0 C:4-99

Lineage for d1ty0c1 (1ty0 C:4-99)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Streptococcal pyrogenic exotoxin Spe-J [110192] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [110193] (2 PDB entries)

8. Domain d1ty0c1: 1ty0 C:4-99 [107444]
   Other proteins in same PDB: d1ty0a2, d1ty0b2, d1ty0c2

Details for d1ty0c1

PDB Entry: 1ty0, 1.75 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)

SCOP Domain Sequences for d1ty0c1:

Sequence; same for both SEQRES and ATOM records:

>d1ty0c1 b.40.2.2 (C:4-99) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes}
senikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyittk
ftknqkvnifglpyiftrydvyyiyggvtpsvnsns

Timeline for d1ty0c1:

• d1ty0c1 is new in SCOP 1.69
  
• d1ty0c1 appears in SCOP 1.71
  
• d1ty0c1 appears in the current release, SCOPe 2.08