SCOP 1.71: Domain d1ty0a2: 1ty0 A:104-211

Lineage for d1ty0a2 (1ty0 A:104-211)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Streptococcal pyrogenic exotoxin Spe-J [110812] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [110813] (2 PDB entries)

8. Domain d1ty0a2: 1ty0 A:104-211 [107441]
   Other proteins in same PDB: d1ty0a1, d1ty0b1, d1ty0c1

Details for d1ty0a2

PDB Entry: 1ty0, 1.75 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)

SCOP Domain Sequences for d1ty0a2:

Sequence; same for both SEQRES and ATOM records:

>d1ty0a2 d.15.6.1 (A:104-211) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes}
ivgnllidgvqqktlinpikidkpiftiqefdfkirqylmqtykiydpnspyikgqleia
ingnkhesfnlydatssstrsdifkkykdnktinmkdfshfdiylwtk

Timeline for d1ty0a2:

• d1ty0a2 first appeared in SCOP 1.69
  
• d1ty0a2 appears in SCOP 1.73
  
• d1ty0a2 appears in the current release, SCOPe 2.08