Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
Protein Streptococcal pyrogenic exotoxin Spe-J [110812] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [110813] (2 PDB entries) |
Domain d1ty0a2: 1ty0 A:104-211 [107441] Other proteins in same PDB: d1ty0a1, d1ty0b1, d1ty0c1 |
PDB Entry: 1ty0 (more details), 1.75 Å
SCOP Domain Sequences for d1ty0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty0a2 d.15.6.1 (A:104-211) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes} ivgnllidgvqqktlinpikidkpiftiqefdfkirqylmqtykiydpnspyikgqleia ingnkhesfnlydatssstrsdifkkykdnktinmkdfshfdiylwtk
Timeline for d1ty0a2:
View in 3D Domains from other chains: (mouse over for more information) d1ty0b1, d1ty0b2, d1ty0c1, d1ty0c2 |