Lineage for d1ty0a2 (1ty0 A:104-211)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. Protein Streptococcal pyrogenic exotoxin Spe-J [110812] (1 species)
  7. Species Streptococcus pyogenes [TaxId:1314] [110813] (2 PDB entries)
    Uniprot Q7BAE3
  8. Domain d1ty0a2: 1ty0 A:104-211 [107441]
    Other proteins in same PDB: d1ty0a1, d1ty0b1, d1ty0c1

Details for d1ty0a2

PDB Entry: 1ty0 (more details), 1.75 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)
PDB Compounds: (A:) putative exotoxin (superantigen)

SCOPe Domain Sequences for d1ty0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty0a2 d.15.6.1 (A:104-211) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes [TaxId: 1314]}
ivgnllidgvqqktlinpikidkpiftiqefdfkirqylmqtykiydpnspyikgqleia
ingnkhesfnlydatssstrsdifkkykdnktinmkdfshfdiylwtk

SCOPe Domain Coordinates for d1ty0a2 are not available.

Timeline for d1ty0a2:

Domains from same chain:
(mouse over for more information)
d1ty0a1
Domains from other chains:
(mouse over for more information)
d1ty0b1, d1ty0b2, d1ty0c1, d1ty0c2