Lineage for d1ty0a1 (1ty0 A:4-99)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559492Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 559592Protein Streptococcal pyrogenic exotoxin Spe-J [110192] (1 species)
  7. 559593Species Streptococcus pyogenes [TaxId:1314] [110193] (2 PDB entries)
  8. 559594Domain d1ty0a1: 1ty0 A:4-99 [107440]
    Other proteins in same PDB: d1ty0a2, d1ty0b2, d1ty0c2

Details for d1ty0a1

PDB Entry: 1ty0 (more details), 1.75 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)

SCOP Domain Sequences for d1ty0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty0a1 b.40.2.2 (A:4-99) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes}
senikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyittk
ftknqkvnifglpyiftrydvyyiyggvtpsvnsns

SCOP Domain Coordinates for d1ty0a1:

Click to download the PDB-style file with coordinates for d1ty0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ty0a1: