Lineage for d1txua_ (1txu A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450728Fold a.222: VPS9 domain (Pfam 02204) [109992] (1 superfamily)
    multihelical; consist of two subdomains
  4. 450729Superfamily a.222.1: VPS9 domain (Pfam 02204) [109993] (1 family) (S)
  5. 450730Family a.222.1.1: VPS9 domain (Pfam 02204) [109994] (1 protein)
  6. 450731Protein Rab5 GDP/GTP exchange factor (Rabex-5) [109995] (1 species)
  7. 450732Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109996] (1 PDB entry)
  8. 450733Domain d1txua_: 1txu A: [107439]

Details for d1txua_

PDB Entry: 1txu (more details), 2.35 Å

PDB Description: crystal structure of the vps9 domain of rabex-5

SCOP Domain Sequences for d1txua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txua_ a.222.1.1 (A:) Rab5 GDP/GTP exchange factor (Rabex-5) {Human (Homo sapiens), gamma isoform}
etdrvskefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaerm
qtrgkvppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqml
cvpvnedipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasad
dflptliyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqs
lnlsqedfdrymsg

SCOP Domain Coordinates for d1txua_:

Click to download the PDB-style file with coordinates for d1txua_.
(The format of our PDB-style files is described here.)

Timeline for d1txua_: