SCOPe 2.08: Domain d1txtd2: 1txt D:168-388

Lineage for d1txtd2 (1txt D:168-388)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species)
   most similar to FabH

7. Species Staphylococcus aureus [TaxId:1280] [419513] (5 PDB entries)
   Uniprot Q7A3F6

8. Domain d1txtd2: 1txt D:168-388 [107438]
   Other proteins in same PDB: d1txta1, d1txtb1, d1txtc1, d1txtd1
   complexed with caa
   has additional subdomain(s) that are not in the common domain

Details for d1txtd2

PDB Entry: 1txt, 2.5 Å

PDB Description: Staphylococcus aureus 3-hydroxy-3-methylglutaryl-CoA synthase

PDB Compounds: (D:) 3-hydroxy-3-methylglutaryl-CoA synthase

SCOPe Domain Sequences for d1txtd2:

Sequence; same for both SEQRES and ATOM records:

>d1txtd2 c.95.1.2 (D:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
ilalnedavaytedvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladf
aslcfhvpftkmgkkalesiidnadettqerlrsgyedavdynryvgniytgslylslis
llenrdlqagetiglfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdaye
tffkrfddvefdeeqdavhedrhifylsniennvreyhrpe

Timeline for d1txtd2:

• d1txtd2 first appeared in SCOP 1.69
  
• d1txtd2 appears in SCOPe 2.07