SCOPe 2.08: Domain d1txtb1: 1txt B:2-167

Lineage for d1txtb1 (1txt B:2-167)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species)
   most similar to FabH

7. Species Staphylococcus aureus [TaxId:1280] [419512] (5 PDB entries)
   Uniprot Q7A3F6

8. Domain d1txtb1: 1txt B:2-167 [107433]
   Other proteins in same PDB: d1txta2, d1txtb2, d1txtc2, d1txtd2
   complexed with caa

Details for d1txtb1

PDB Entry: 1txt, 2.5 Å

PDB Description: Staphylococcus aureus 3-hydroxy-3-methylglutaryl-CoA synthase

PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-CoA synthase

SCOPe Domain Sequences for d1txtb1:

Sequence; same for both SEQRES and ATOM records:

>d1txtb1 c.95.1.2 (B:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnps

Timeline for d1txtb1:

• d1txtb1 first appeared in SCOP 1.69
  
• d1txtb1 appears in SCOPe 2.07