Lineage for d1txta1 (1txt A:2-167)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495506Family c.95.1.2: Chalcone synthase-like [53914] (7 proteins)
  6. 495507Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (1 species)
    most similar to FabH
  7. 495508Species Staphylococcus aureus [TaxId:1280] [110761] (2 PDB entries)
  8. 495511Domain d1txta1: 1txt A:2-167 [107431]

Details for d1txta1

PDB Entry: 1txt (more details), 2.5 Å

PDB Description: Staphylococcus aureus 3-hydroxy-3-methylglutaryl-CoA synthase

SCOP Domain Sequences for d1txta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txta1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus}
tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiqla
kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnps

SCOP Domain Coordinates for d1txta1:

Click to download the PDB-style file with coordinates for d1txta1.
(The format of our PDB-style files is described here.)

Timeline for d1txta1: