Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (7 proteins) |
Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (1 species) most similar to FabH |
Species Staphylococcus aureus [TaxId:1280] [110761] (2 PDB entries) |
Domain d1txta1: 1txt A:2-167 [107431] |
PDB Entry: 1txt (more details), 2.5 Å
SCOP Domain Sequences for d1txta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txta1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus} tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeaayaatpaiqla kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnps
Timeline for d1txta1: