Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins) bacterial metal-binding, lipocalin-like protein automatically mapped to Pfam PF09223 |
Protein Hypothetical protein YodA [101864] (3 species) |
Species Escherichia coli [TaxId:562] [101865] (6 PDB entries) Uniprot P76344 |
Domain d1txla_: 1txl A: [107429] Structural genomics target complexed with zn |
PDB Entry: 1txl (more details), 1.7 Å
SCOPe Domain Sequences for d1txla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txla_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]} hgkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktk tfaeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvryl feckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlssee vveemmsh
Timeline for d1txla_: