Lineage for d1txkb2 (1txk B:23-396)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 556788Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 556864Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 557143Family b.30.5.9: MdoG-like [110148] (1 protein)
    Pfam 04349; Pfam coverage extends to the C-terminal immunoglobulin-like domain
  6. 557144Protein Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain [110149] (1 species)
  7. 557145Species Escherichia coli [TaxId:562] [110150] (1 PDB entry)
  8. 557147Domain d1txkb2: 1txk B:23-396 [107428]
    Other proteins in same PDB: d1txka1, d1txkb1
    complexed with na

Details for d1txkb2

PDB Entry: 1txk (more details), 2.5 Å

PDB Description: Crystal structure of Escherichia coli OpgG

SCOP Domain Sequences for d1txkb2:

Sequence, based on SEQRES records: (download)

>d1txkb2 b.30.5.9 (B:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli}
fsiddvakqaqslagkgyetpksnlpsvfrdmkyadyqqiqfnhdkaywnnlktpfklef
yhqgmyfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypinsk
dkndeivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdkr
ltiyalldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqps
pannyrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsrf
edlddrydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnfk
ytitfsrdedklha

Sequence, based on observed residues (ATOM records): (download)

>d1txkb2 b.30.5.9 (B:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli}
fsiddvakqaqslagkgyetpksnlpsmkyadyqqiqfnhdkaywnnlktpfklefyhqg
myfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypinskdknd
eivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdkrltiy
alldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqpspann
yrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsrfedld
drydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnfkytit
fsrdedklha

SCOP Domain Coordinates for d1txkb2:

Click to download the PDB-style file with coordinates for d1txkb2.
(The format of our PDB-style files is described here.)

Timeline for d1txkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1txkb1