SCOPe 2.07: Domain d1txkb1: 1txk B:397-511

Lineage for d1txkb1 (1txk B:397-511)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain [110054] (1 species)

7. Species Escherichia coli [TaxId:562] [110055] (1 PDB entry)
   Uniprot P33136 23-511

8. Domain d1txkb1: 1txk B:397-511 [107427]
   Other proteins in same PDB: d1txka2, d1txka3, d1txkb2, d1txkb3
   complexed with na

Details for d1txkb1

PDB Entry: 1txk, 2.5 Å

PDB Description: Crystal structure of Escherichia coli OpgG

PDB Compounds: (B:) Glucans biosynthesis protein G

SCOPe Domain Sequences for d1txkb1:

Sequence; same for both SEQRES and ATOM records:

>d1txkb1 b.1.18.2 (B:397-511) Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain {Escherichia coli [TaxId: 562]}
pdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpedtpvtaqtsigdnge
ivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlsetwsyqlpane

Timeline for d1txkb1:

• d1txkb1 first appeared in SCOP 1.69
  
• d1txkb1 appears in SCOPe 2.06
  
• d1txkb1 appears in the current release, SCOPe 2.08