![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain [110054] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110055] (1 PDB entry) Uniprot P33136 23-511 |
![]() | Domain d1txkb1: 1txk B:397-511 [107427] Other proteins in same PDB: d1txka2, d1txka3, d1txkb2, d1txkb3 complexed with na |
PDB Entry: 1txk (more details), 2.5 Å
SCOPe Domain Sequences for d1txkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txkb1 b.1.18.2 (B:397-511) Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain {Escherichia coli [TaxId: 562]} pdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpedtpvtaqtsigdnge ivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlsetwsyqlpane
Timeline for d1txkb1: