Lineage for d1txkb1 (1txk B:397-511)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038694Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2038829Protein Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain [110054] (1 species)
  7. 2038830Species Escherichia coli [TaxId:562] [110055] (1 PDB entry)
    Uniprot P33136 23-511
  8. 2038832Domain d1txkb1: 1txk B:397-511 [107427]
    Other proteins in same PDB: d1txka2, d1txka3, d1txkb2, d1txkb3
    complexed with na

Details for d1txkb1

PDB Entry: 1txk (more details), 2.5 Å

PDB Description: Crystal structure of Escherichia coli OpgG
PDB Compounds: (B:) Glucans biosynthesis protein G

SCOPe Domain Sequences for d1txkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txkb1 b.1.18.2 (B:397-511) Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain {Escherichia coli [TaxId: 562]}
pdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpedtpvtaqtsigdnge
ivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlsetwsyqlpane

SCOPe Domain Coordinates for d1txkb1:

Click to download the PDB-style file with coordinates for d1txkb1.
(The format of our PDB-style files is described here.)

Timeline for d1txkb1: