SCOP 1.71: Domain d1txkb1: 1txk B:397-511

Lineage for d1txkb1 (1txk B:397-511)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain [110054] (1 species)

7. Species Escherichia coli [TaxId:562] [110055] (1 PDB entry)

8. Domain d1txkb1: 1txk B:397-511 [107427]
   Other proteins in same PDB: d1txka2, d1txkb2
   complexed with na

Details for d1txkb1

PDB Entry: 1txk, 2.5 Å

PDB Description: Crystal structure of Escherichia coli OpgG

SCOP Domain Sequences for d1txkb1:

Sequence; same for both SEQRES and ATOM records:

>d1txkb1 b.1.18.2 (B:397-511) Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain {Escherichia coli}
pdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpedtpvtaqtsigdnge
ivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlsetwsyqlpane

Timeline for d1txkb1:

• d1txkb1 first appeared in SCOP 1.69
  
• d1txkb1 appears in SCOP 1.73
  
• d1txkb1 appears in the current release, SCOPe 2.08