Lineage for d1txja_ (1txj A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811449Fold b.88: Mss4-like [51315] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 811450Superfamily b.88.1: Mss4-like [51316] (4 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 811460Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (1 protein)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
  6. 811461Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)
  7. 811471Species Plasmodium knowlesi [TaxId:5850] [110332] (1 PDB entry)
    Uniprot P84152
  8. 811472Domain d1txja_: 1txj A: [107424]
    Structural genomics target

Details for d1txja_

PDB Entry: 1txj (more details), 2 Å

PDB Description: Crystal structure of translationally controlled tumour-associated protein (TCTP) from Plasmodium knowlesi
PDB Compounds: (A:) translationally controlled tumour-associated protein (TCTP) from Plasmodium knowlesi, PKN_PFE0545c

SCOP Domain Sequences for d1txja_:

Sequence, based on SEQRES records: (download)

>d1txja_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Plasmodium knowlesi [TaxId: 5850]}
mkvykdvftndevcsdsynqedpfgiadfreiafevksnkrikgnddygiadnseeavdg
mgadveqvidivdsfqltstslskkeysvyiknymqkilkyleekkpdrvdvfktkaqpl
ikhiltnfddfefymgesldmdagltysyykgeevtprfvyisdglyeekf

Sequence, based on observed residues (ATOM records): (download)

>d1txja_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Plasmodium knowlesi [TaxId: 5850]}
mkvykdvftndevcsdsynqedpfgiadfreiafevksnkrikgngmgadveqvidivds
fqltstslskkeysvyiknymqkilkyleekkpdrvdvfktkaqplikhiltnfddfefy
mgesldmdagltysyykgeevtprfvyisdglyeekf

SCOP Domain Coordinates for d1txja_:

Click to download the PDB-style file with coordinates for d1txja_.
(The format of our PDB-style files is described here.)

Timeline for d1txja_: