![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.88: Mss4-like [51315] (1 superfamily) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (3 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.2: Translationally controlled tumor-associated protein tctp, p23fyp [63873] (1 protein) contains an insertion of alpha helical hairpin; lacks zinc-binding site |
![]() | Protein Translationally controlled tumor-associated protein tctp, p23fyp [63874] (2 species) |
![]() | Species Plasmodium knowlesi [TaxId:5850] [110332] (1 PDB entry) |
![]() | Domain d1txja_: 1txj A: [107424] Structural genomics target |
PDB Entry: 1txj (more details), 2 Å
SCOP Domain Sequences for d1txja_:
Sequence, based on SEQRES records: (download)
>d1txja_ b.88.1.2 (A:) Translationally controlled tumor-associated protein tctp, p23fyp {Plasmodium knowlesi} mkvykdvftndevcsdsynqedpfgiadfreiafevksnkrikgnddygiadnseeavdg mgadveqvidivdsfqltstslskkeysvyiknymqkilkyleekkpdrvdvfktkaqpl ikhiltnfddfefymgesldmdagltysyykgeevtprfvyisdglyeekf
>d1txja_ b.88.1.2 (A:) Translationally controlled tumor-associated protein tctp, p23fyp {Plasmodium knowlesi} mkvykdvftndevcsdsynqedpfgiadfreiafevksnkrikgngmgadveqvidivds fqltstslskkeysvyiknymqkilkyleekkpdrvdvfktkaqplikhiltnfddfefy mgesldmdagltysyykgeevtprfvyisdglyeekf
Timeline for d1txja_: