SCOPe 2.08: Domain d1txja_: 1txj A:

Lineage for d1txja_ (1txj A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
   contains an insertion of alpha helical hairpin; lacks zinc-binding site
   automatically mapped to Pfam PF00838

6. Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)

7. Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [110332] (1 PDB entry)
   Uniprot P84152

8. Domain d1txja_: 1txj A: [107424]
   Structural genomics target

Details for d1txja_

PDB Entry: 1txj, 2 Å

PDB Description: Crystal structure of translationally controlled tumour-associated protein (TCTP) from Plasmodium knowlesi

PDB Compounds: (A:) translationally controlled tumour-associated protein (TCTP) from Plasmodium knowlesi, PKN_PFE0545c

SCOPe Domain Sequences for d1txja_:

Sequence, based on SEQRES records:

>d1txja_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
mkvykdvftndevcsdsynqedpfgiadfreiafevksnkrikgnddygiadnseeavdg
mgadveqvidivdsfqltstslskkeysvyiknymqkilkyleekkpdrvdvfktkaqpl
ikhiltnfddfefymgesldmdagltysyykgeevtprfvyisdglyeekf

Sequence, based on observed residues (ATOM records):

>d1txja_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
mkvykdvftndevcsdsynqedpfgiadfreiafevksnkrikgngmgadveqvidivds
fqltstslskkeysvyiknymqkilkyleekkpdrvdvfktkaqplikhiltnfddfefy
mgesldmdagltysyykgeevtprfvyisdglyeekf

Timeline for d1txja_:

• d1txja_ first appeared in SCOP 1.69
  
• d1txja_ appears in SCOPe 2.07