Lineage for d1txda2 (1txd A:1020-1133)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 672999Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
    Pfam PF00169
  6. 673153Protein Rho guanine nucleotide exchange factor 12 [110270] (1 species)
  7. 673154Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110271] (2 PDB entries)
  8. 673155Domain d1txda2: 1txd A:1020-1133 [107423]
    Other proteins in same PDB: d1txda1

Details for d1txda2

PDB Entry: 1txd (more details), 2.13 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 12

SCOP Domain Sequences for d1txda2:

Sequence, based on SEQRES records: (download)

>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
mihegplvwkvnrdktidlytllledilvllqkqddrlvlrchskilastadskhtfspv
iklstvlvrqvatdnkalfvismsdngaqiyelvaqtvsektvwqdlicrmaas

Sequence, based on observed residues (ATOM records): (download)

>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
mihegplvwkvnrdktidlytllledilvllqkqddrlvlrctfspviklstvlvrqvat
nkalfvismsdngaqiyelvaqtvsektvwqdlicrmaas

SCOP Domain Coordinates for d1txda2:

Click to download the PDB-style file with coordinates for d1txda2.
(The format of our PDB-style files is described here.)

Timeline for d1txda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1txda1