Lineage for d1txda1 (1txd A:766-999)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332669Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2332670Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2332671Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2332711Protein Rho guanine nucleotide exchange factor 12 [109937] (1 species)
  7. 2332712Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109938] (2 PDB entries)
    Uniprot Q9NZN5 766-1138
  8. 2332713Domain d1txda1: 1txd A:766-999 [107422]
    Other proteins in same PDB: d1txda2

Details for d1txda1

PDB Entry: 1txd (more details), 2.13 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 12

SCOPe Domain Sequences for d1txda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
ppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregilsp
selrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkhaaa
tfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypllld
niakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrldtssl

SCOPe Domain Coordinates for d1txda1:

Click to download the PDB-style file with coordinates for d1txda1.
(The format of our PDB-style files is described here.)

Timeline for d1txda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1txda2