Lineage for d1txda1 (1txd A:766-999)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445734Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 445735Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 445736Family a.87.1.1: DBL homology domain (DH-domain) [48066] (8 proteins)
    Pfam 00621
  6. 445764Protein Rho guanine nucleotide exchange factor 12 [109937] (1 species)
  7. 445765Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109938] (2 PDB entries)
  8. 445766Domain d1txda1: 1txd A:766-999 [107422]
    Other proteins in same PDB: d1txda2

Details for d1txda1

PDB Entry: 1txd (more details), 2.13 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef

SCOP Domain Sequences for d1txda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform}
ppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregilsp
selrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkhaaa
tfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypllld
niakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrldtssl

SCOP Domain Coordinates for d1txda1:

Click to download the PDB-style file with coordinates for d1txda1.
(The format of our PDB-style files is described here.)

Timeline for d1txda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1txda2