Lineage for d1tx2b_ (1tx2 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. Protein Dihydropteroate synthetase [51719] (5 species)
  7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries)
    Uniprot Q81VW8
  8. Domain d1tx2b_: 1tx2 B: [107421]
    complexed with 680, so4

Details for d1tx2b_

PDB Entry: 1tx2 (more details), 1.83 Å

PDB Description: dihydropteroate synthetase, with bound inhibitor manic, from bacillus anthracis
PDB Compounds: (B:) DHPS, Dihydropteroate synthase

SCOPe Domain Sequences for d1tx2b_:

Sequence, based on SEQRES records: (download)

>d1tx2b_ c.1.21.1 (B:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

Sequence, based on observed residues (ATOM records): (download)

>d1tx2b_ c.1.21.1 (B:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpsdggsynevdaavrhakemrdegahiidigg
vsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiae
vaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktp
eqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefv
rvhdvkemsrmakmmdamigk

SCOPe Domain Coordinates for d1tx2b_ are not available.

Timeline for d1tx2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tx2a_