Lineage for d1tx2a_ (1tx2 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476741Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families) (S)
  5. 476742Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein)
  6. 476743Protein Dihydropteroate synthetase [51719] (4 species)
  7. 476744Species Bacillus anthracis [TaxId:1392] [102103] (5 PDB entries)
  8. 476745Domain d1tx2a_: 1tx2 A: [107420]

Details for d1tx2a_

PDB Entry: 1tx2 (more details), 1.83 Å

PDB Description: dihydropteroate synthetase, with bound inhibitor manic, from bacillus anthracis

SCOP Domain Sequences for d1tx2a_:

Sequence, based on SEQRES records: (download)

>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

Sequence, based on observed residues (ATOM records): (download)

>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggesfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwga
kaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildp
gigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclg
iekgcefvrvhdvkemsrmakmmdamigk

SCOP Domain Coordinates for d1tx2a_:

Click to download the PDB-style file with coordinates for d1tx2a_.
(The format of our PDB-style files is described here.)

Timeline for d1tx2a_: