Lineage for d1tx0b_ (1tx0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089691Protein Dihydropteroate synthetase [51719] (4 species)
  7. 2089692Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries)
    Uniprot Q81VW8
  8. 2089712Domain d1tx0b_: 1tx0 B: [107419]
    complexed with pt1, so4

Details for d1tx0b_

PDB Entry: 1tx0 (more details), 2.15 Å

PDB Description: dihydropteroate synthetase, with bound product analogue pteroic acid, from bacillus anthracis
PDB Compounds: (B:) DHPS, Dihydropteroate synthase

SCOPe Domain Sequences for d1tx0b_:

Sequence, based on SEQRES records: (download)

>d1tx0b_ c.1.21.1 (B:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

Sequence, based on observed residues (ATOM records): (download)

>d1tx0b_ c.1.21.1 (B:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpsdggsynevdaavrhakemrdegahiidigg
vsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiae
vaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktp
eqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefv
rvhdvkemsrmakmmdamigk

SCOPe Domain Coordinates for d1tx0b_:

Click to download the PDB-style file with coordinates for d1tx0b_.
(The format of our PDB-style files is described here.)

Timeline for d1tx0b_: