![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.8: Hypothetical protein YycE [110888] (1 protein) subunit fold and dimeric assembly are similar to those of glyoxalase automatically mapped to Pfam PF00903 |
![]() | Protein Hypothetical protein YycE [110889] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [110890] (1 PDB entry) Uniprot P37479 |
![]() | Domain d1twua_: 1twu A: [107413] |
PDB Entry: 1twu (more details), 2 Å
SCOPe Domain Sequences for d1twua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} krfssfqaaqiriarptgqldeiirfyeeglclkrigefsqhngydgvmfglphadyhle ftqyeggstapvphpdsllvfyvpnavelaaitsklkhmgyqevesenpywsnggvtied pdgwrivfmnskgisgk
Timeline for d1twua_: