Lineage for d1twua_ (1twu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942861Family d.32.1.8: Hypothetical protein YycE [110888] (1 protein)
    subunit fold and dimeric assembly are similar to those of glyoxalase
    automatically mapped to Pfam PF00903
  6. 2942862Protein Hypothetical protein YycE [110889] (1 species)
  7. 2942863Species Bacillus subtilis [TaxId:1423] [110890] (1 PDB entry)
    Uniprot P37479
  8. 2942864Domain d1twua_: 1twu A: [107413]

Details for d1twua_

PDB Entry: 1twu (more details), 2 Å

PDB Description: 2.0 A Crystal Structure of a YycE Protein of Unknown Function from Bacillus subtilis, Putative Glyoxalase/Fosfomycin Resistance Protein
PDB Compounds: (A:) Hypothetical protein yycE

SCOPe Domain Sequences for d1twua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]}
krfssfqaaqiriarptgqldeiirfyeeglclkrigefsqhngydgvmfglphadyhle
ftqyeggstapvphpdsllvfyvpnavelaaitsklkhmgyqevesenpywsnggvtied
pdgwrivfmnskgisgk

SCOPe Domain Coordinates for d1twua_:

Click to download the PDB-style file with coordinates for d1twua_.
(The format of our PDB-style files is described here.)

Timeline for d1twua_: