SCOP 1.73: Domain d1twsa_: 1tws A:

Lineage for d1twsa_ (1tws A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein)

6. Protein Dihydropteroate synthetase [51719] (4 species)

7. Species Bacillus anthracis [TaxId:1392] [102103] (5 PDB entries)

8. Domain d1twsa_: 1tws A: [107411]

Details for d1twsa_

PDB Entry: 1tws, 2 Å

PDB Description: dihydropteroate synthetase from bacillus anthracis

PDB Compounds: (A:) DHPS, Dihydropteroate synthase

SCOP Domain Sequences for d1twsa_:

Sequence; same for both SEQRES and ATOM records:

>d1twsa_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

Timeline for d1twsa_:

• d1twsa_ first appeared in SCOP 1.69
  
• d1twsa_ appears in SCOP 1.71
  
• d1twsa_ appears in SCOP 1.75
  
• d1twsa_ appears in the current release, SCOPe 2.08