Lineage for d1twsa_ (1tws A:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families) 
Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein) Protein Dihydropteroate synthetase [51719] (4 species) 
Species Bacillus anthracis [TaxId:1392] [102103] (5 PDB entries) 
Domain d1twsa_: 1tws A: [107411]
Details for d1twsa_
PDB Entry: 1tws (more details), 2 Å
PDB Description: dihydropteroate synthetase from bacillus anthracis
SCOP Domain Sequences for d1twsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twsa_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk
SCOP Domain Coordinates for d1twsa_:
Click to download the PDB-style file with coordinates for d1twsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1twsa_:
- d1twsa_ is new in SCOP 1.69
- d1twsa_ appears in SCOP 1.71
- d1twsa_ appears in the current release, SCOPe 2.08
View in 3D
