Lineage for d1twib1 (1twi B:15-49,B:314-448)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067498Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2067534Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 2067535Protein Diaminopimelate decarboxylase LysA [89350] (3 species)
  7. 2067539Species Methanococcus jannaschii [TaxId:2190] [110245] (2 PDB entries)
    Uniprot Q58497
  8. 2067541Domain d1twib1: 1twi B:15-49,B:314-448 [107401]
    Other proteins in same PDB: d1twia2, d1twib2, d1twic2, d1twid2
    Structural genomics target
    complexed with lys, mg, plp

Details for d1twib1

PDB Entry: 1twi (more details), 2 Å

PDB Description: crystal structure of diaminopimelate decarboxylase from m. jannaschii in co-complex with l-lysine
PDB Compounds: (B:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1twib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twib1 b.49.2.3 (B:15-49,B:314-448) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]}
mlgndtveikdgrffidgydaielaekfgtplyvmXgyllgkvhhiketpvtkwvmidag
mndmmrpamyeayhhiinckvknekevvsiagglcessdvfgrdreldkvevgdvlaifd
vgaygismannynargrprmvltskkgvflireretyadliakdivpphll

SCOPe Domain Coordinates for d1twib1:

Click to download the PDB-style file with coordinates for d1twib1.
(The format of our PDB-style files is described here.)

Timeline for d1twib1: