Lineage for d1twdb_ (1twd B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.30: CutC-like [110395] (2 families) 
automatically mapped to Pfam PF03932Family c.1.30.1: CutC-like [110396] (2 proteins)
Pfam PF03932Protein Copper homeostasis protein CutC [110397] (1 species) Species Shigella flexneri [TaxId:623] [110398] (1 PDB entry)
Uniprot P67825
Domain d1twdb_: 1twd B: [107398]
Structural genomics target
Details for d1twdb_
PDB Entry: 1twd (more details), 1.7 Å
PDB Description: crystal structure of the putative copper homeostasis protein (cutc) from shigella flexneri, northeast structural genomics target sfr33
PDB Compounds: (B:) Copper homeostasis protein cutCSCOPe Domain Sequences for d1twdb_:
Sequence, based on SEQRES records: (download)
>d1twdb_ c.1.30.1 (B:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkgi
ierhqakl
Sequence, based on observed residues (ATOM records): (download)
>d1twdb_ c.1.30.1 (B:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryreysryivdgaavaemkgiierhqakl
SCOPe Domain Coordinates for d1twdb_:
Click to download the PDB-style file with coordinates for d1twdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1twdb_:
- d1twdb_ first appeared in SCOP 1.69
- d1twdb_ appears in SCOPe 2.04
- d1twdb_ is called d1twdb1 in SCOPe 2.06
- d1twdb_ appears in the current release, SCOPe 2.08, called d1twdb1
View in 3D
