Lineage for d1twdb_ (1twd B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1826517Superfamily c.1.30: CutC-like [110395] (2 families) (S)
    automatically mapped to Pfam PF03932
  5. 1826518Family c.1.30.1: CutC-like [110396] (2 proteins)
    Pfam PF03932
  6. 1826519Protein Copper homeostasis protein CutC [110397] (1 species)
  7. 1826520Species Shigella flexneri [TaxId:623] [110398] (1 PDB entry)
    Uniprot P67825
  8. 1826522Domain d1twdb_: 1twd B: [107398]
    Structural genomics target

Details for d1twdb_

PDB Entry: 1twd (more details), 1.7 Å

PDB Description: crystal structure of the putative copper homeostasis protein (cutc) from shigella flexneri, northeast structural genomics target sfr33
PDB Compounds: (B:) Copper homeostasis protein cutC

SCOPe Domain Sequences for d1twdb_:

Sequence, based on SEQRES records: (download)

>d1twdb_ c.1.30.1 (B:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkgi
ierhqakl

Sequence, based on observed residues (ATOM records): (download)

>d1twdb_ c.1.30.1 (B:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryreysryivdgaavaemkgiierhqakl

SCOPe Domain Coordinates for d1twdb_:

Click to download the PDB-style file with coordinates for d1twdb_.
(The format of our PDB-style files is described here.)

Timeline for d1twdb_:

Domains from other chains:
(mouse over for more information)
d1twda_