Lineage for d1twdb1 (1twd B:2-248)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090147Superfamily c.1.30: CutC-like [110395] (2 families) (S)
    automatically mapped to Pfam PF03932
  5. 2090148Family c.1.30.1: CutC-like [110396] (2 protein domains)
    Pfam PF03932
  6. 2090149Protein Copper homeostasis protein CutC [110397] (1 species)
  7. 2090150Species Shigella flexneri [TaxId:623] [110398] (1 PDB entry)
    Uniprot P67825
  8. 2090152Domain d1twdb1: 1twd B:2-248 [107398]
    Other proteins in same PDB: d1twdb2
    Structural genomics target

Details for d1twdb1

PDB Entry: 1twd (more details), 1.7 Å

PDB Description: crystal structure of the putative copper homeostasis protein (cutc) from shigella flexneri, northeast structural genomics target sfr33
PDB Compounds: (B:) Copper homeostasis protein cutC

SCOPe Domain Sequences for d1twdb1:

Sequence, based on SEQRES records: (download)

>d1twdb1 c.1.30.1 (B:2-248) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkgi
ierhqak

Sequence, based on observed residues (ATOM records): (download)

>d1twdb1 c.1.30.1 (B:2-248) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryreysryivdgaavaemkgiierhqak

SCOPe Domain Coordinates for d1twdb1:

Click to download the PDB-style file with coordinates for d1twdb1.
(The format of our PDB-style files is described here.)

Timeline for d1twdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1twdb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1twda_