Lineage for d1twda_ (1twd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2449297Superfamily c.1.30: CutC-like [110395] (2 families) (S)
    automatically mapped to Pfam PF03932
  5. 2449298Family c.1.30.1: CutC-like [110396] (2 proteins)
    Pfam PF03932
  6. 2449299Protein Copper homeostasis protein CutC [110397] (1 species)
  7. 2449300Species Shigella flexneri [TaxId:623] [110398] (1 PDB entry)
    Uniprot P67825
  8. 2449301Domain d1twda_: 1twd A: [107397]
    Other proteins in same PDB: d1twdb2
    Structural genomics target

Details for d1twda_

PDB Entry: 1twd (more details), 1.7 Å

PDB Description: crystal structure of the putative copper homeostasis protein (cutc) from shigella flexneri, northeast structural genomics target sfr33
PDB Compounds: (A:) Copper homeostasis protein cutC

SCOPe Domain Sequences for d1twda_:

Sequence, based on SEQRES records: (download)

>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkgi
ierhqak

Sequence, based on observed residues (ATOM records): (download)

>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrnysryivdgaavaemkgiierhqak

SCOPe Domain Coordinates for d1twda_:

Click to download the PDB-style file with coordinates for d1twda_.
(The format of our PDB-style files is described here.)

Timeline for d1twda_: