Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.30: CutC-like (Pfam 03932) [110395] (1 family) |
Family c.1.30.1: CutC-like (Pfam 03932) [110396] (1 protein) |
Protein Copper homeostasis protein CutC [110397] (1 species) |
Species Shigella flexneri [TaxId:623] [110398] (1 PDB entry) |
Domain d1twda_: 1twd A: [107397] |
PDB Entry: 1twd (more details), 1.7 Å
SCOP Domain Sequences for d1twda_:
Sequence, based on SEQRES records: (download)
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri} alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra enlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkgi ierhqak
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri} alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra enlhhfldagvlevhssagawqaspmryrnysryivdgaavaemkgiierhqak
Timeline for d1twda_: