SCOP 1.75: Domain d1tw9h2: 1tw9 H:1-77

Lineage for d1tw9h2 (1tw9 H:1-77)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (23 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class sigma GST [81362] (5 species)
Species Heligmosomoides polygyrus [TaxId:6339] [110608] (1 PDB entry)
Uniprot Q9NJQ6 # Fragment
Domain d1tw9h2: 1tw9 H:1-77 [107396]
Other proteins in same PDB: d1tw9a1, d1tw9b1, d1tw9c1, d1tw9d1, d1tw9e1, d1tw9f1, d1tw9g1, d1tw9h1

Details for d1tw9h2

PDB Entry: 1tw9 (more details), 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus

PDB Compounds: (H:) Glutathione S-transferase 2

SCOP Domain Sequences for d1tw9h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw9h2 c.47.1.5 (H:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}
mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
laqsqaicrylaktfgf

SCOP Domain Coordinates for d1tw9h2:

Click to download the PDB-style file with coordinates for d1tw9h2.
(The format of our PDB-style files is described here.)

Timeline for d1tw9h2: