Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Class sigma GST [81362] (5 species) |
Species Heligmosomoides polygyrus [TaxId:6339] [110608] (1 PDB entry) |
Domain d1tw9g2: 1tw9 G:1-77 [107394] Other proteins in same PDB: d1tw9a1, d1tw9b1, d1tw9c1, d1tw9d1, d1tw9e1, d1tw9f1, d1tw9g1, d1tw9h1 |
PDB Entry: 1tw9 (more details), 1.71 Å
SCOP Domain Sequences for d1tw9g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw9g2 c.47.1.5 (G:1-77) Class sigma GST {Heligmosomoides polygyrus} mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq laqsqaicrylaktfgf
Timeline for d1tw9g2: