![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class sigma GST [81362] (5 species) |
![]() | Species Heligmosomoides polygyrus [TaxId:6339] [110608] (1 PDB entry) Uniprot Q9NJQ6 # Fragment |
![]() | Domain d1tw9b2: 1tw9 B:3-77 [107384] Other proteins in same PDB: d1tw9a1, d1tw9a3, d1tw9b1, d1tw9b3, d1tw9c1, d1tw9c3, d1tw9d1, d1tw9d3, d1tw9e1, d1tw9e3, d1tw9f1, d1tw9f3, d1tw9g1, d1tw9g3, d1tw9h1, d1tw9h3 |
PDB Entry: 1tw9 (more details), 1.71 Å
SCOPe Domain Sequences for d1tw9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw9b2 c.47.1.5 (B:3-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} hykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqqla qsqaicrylaktfgf
Timeline for d1tw9b2: